Lineage for d1ecya_ (1ecy A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383681Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2383682Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2383683Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. 2383684Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2383685Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2383702Domain d1ecya_: 1ecy A: [23697]
    complexed with bgc, glc

Details for d1ecya_

PDB Entry: 1ecy (more details), 2.19 Å

PDB Description: protease inhibitor ecotin
PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1ecya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecya_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr

SCOPe Domain Coordinates for d1ecya_:

Click to download the PDB-style file with coordinates for d1ecya_.
(The format of our PDB-style files is described here.)

Timeline for d1ecya_: