SCOPe 2.06: Domain d1ecya_: 1ecy A:

Lineage for d1ecya_ (1ecy A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1ecya_: 1ecy A: [23697]
   complexed with bgc, glc

Details for d1ecya_

PDB Entry: 1ecy, 2.19 Å

PDB Description: protease inhibitor ecotin

PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1ecya_:

Sequence; same for both SEQRES and ATOM records:

>d1ecya_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr

Timeline for d1ecya_:

• d1ecya_ first appeared (with stable ids) in SCOP 1.55, called d1ecy__
  
• d1ecya_ appears in SCOPe 2.05
  
• d1ecya_ appears in SCOPe 2.07
  
• d1ecya_ appears in the current release, SCOPe 2.08