SCOP 1.59: Domain d1ecy__: 1ecy -

Lineage for d1ecy__ (1ecy -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)

8. Domain d1ecy__: 1ecy - [23697]

Details for d1ecy__

PDB Entry: 1ecy, 2.19 Å

PDB Description: protease inhibitor ecotin

SCOP Domain Sequences for d1ecy__:

Sequence; same for both SEQRES and ATOM records:

>d1ecy__ b.16.1.1 (-) Ecotin, trypsin inhibitor {Escherichia coli}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr

Timeline for d1ecy__:

• d1ecy__ first appeared (with stable ids) in SCOP 1.55
  
• d1ecy__ appears in SCOP 1.57
  
• d1ecy__ appears in SCOP 1.61
  
• d1ecy__ appears in the current release, SCOPe 2.08, called d1ecya_