| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Escherichia coli [TaxId:562] [225333] (3 PDB entries) |
| Domain d4bwld1: 4bwl D:2-295 [236963] Other proteins in same PDB: d4bwla2, d4bwlc2, d4bwld2 automated match to d2rfgb_ complexed with 1pe, mn9, si3; mutant |
PDB Entry: 4bwl (more details), 2 Å
SCOPe Domain Sequences for d4bwld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bwld1 c.1.10.0 (D:2-295) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvanipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirreh
pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqe
Timeline for d4bwld1: