SCOPe 2.06: Domain d4bwlc1: 4bwl C:2-296

Lineage for d4bwlc1 (4bwl C:2-296)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225333] (3 PDB entries)

8. Domain d4bwlc1: 4bwl C:2-296 [236961]
   Other proteins in same PDB: d4bwla2, d4bwlc2, d4bwld2
   automated match to d2rfgb_
   complexed with 1pe, mn9, si3; mutant

Details for d4bwlc1

PDB Entry: 4bwl, 2 Å

PDB Description: Structure of the Y137A mutant of E. coli N-acetylneuraminic acid lyase in complex with pyruvate, N-acetyl-D-mannosamine and N- acetylneuraminic acid

PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4bwlc1:

Sequence; same for both SEQRES and ATOM records:

>d4bwlc1 c.1.10.0 (C:2-296) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvanipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

Timeline for d4bwlc1:

• d4bwlc1 first appeared in SCOPe 2.03, called d4bwlc_
  
• d4bwlc1 was called d4bwlc_ in SCOPe 2.05
  
• d4bwlc1 appears in SCOPe 2.07
  
• d4bwlc1 appears in the current release, SCOPe 2.08