Lineage for d4bwlc1 (4bwl C:2-296)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836283Species Escherichia coli [TaxId:562] [225333] (3 PDB entries)
  8. 2836286Domain d4bwlc1: 4bwl C:2-296 [236961]
    Other proteins in same PDB: d4bwla2, d4bwlc2, d4bwld2
    automated match to d2rfgb_
    complexed with 1pe, mn9, si3; mutant

Details for d4bwlc1

PDB Entry: 4bwl (more details), 2 Å

PDB Description: Structure of the Y137A mutant of E. coli N-acetylneuraminic acid lyase in complex with pyruvate, N-acetyl-D-mannosamine and N- acetylneuraminic acid
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4bwlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bwlc1 c.1.10.0 (C:2-296) automated matches {Escherichia coli [TaxId: 562]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvanipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

SCOPe Domain Coordinates for d4bwlc1:

Click to download the PDB-style file with coordinates for d4bwlc1.
(The format of our PDB-style files is described here.)

Timeline for d4bwlc1: