SCOP 1.71: Domain d1ezub_: 1ezu B:

Lineage for d1ezub_ (1ezu B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)

8. Domain d1ezub_: 1ezu B: [23696]
   Other proteins in same PDB: d1ezuc_, d1ezud_
   complexed with ca; mutant

Details for d1ezub_

PDB Entry: 1ezu, 2.4 Å

PDB Description: ecotin y69f, d70p bound to d102n trypsin

SCOP Domain Sequences for d1ezub_:

Sequence; same for both SEQRES and ATOM records:

>d1ezub_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli}
svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
tlegwgfpyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
vdvkyrvwkaeekidnavvr

Timeline for d1ezub_:

• d1ezub_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezub_ appears in SCOP 1.69
  
• d1ezub_ appears in SCOP 1.73
  
• d1ezub_ appears in the current release, SCOPe 2.08