SCOPe 2.07: Domain d4buqb_: 4buq B:

Lineage for d4buqb_ (4buq B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (25 PDB entries)

8. Domain d4buqb_: 4buq B: [236958]
   automated match to d1uwfa_
   complexed with kgm

Details for d4buqb_

PDB Entry: 4buq, 2.2 Å

PDB Description: crystal structure of wild type fimh lectin domain in complex with heptyl alpha-d-mannopyrannoside

PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d4buqb_:

Sequence; same for both SEQRES and ATOM records:

>d4buqb_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4buqb_:

• d4buqb_ first appeared in SCOPe 2.03
  
• d4buqb_ appears in SCOPe 2.06
  
• d4buqb_ appears in the current release, SCOPe 2.08