SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4buqb_ (4buq B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2033958Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2033959Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 2033989Domain d4buqb_: 4buq B: [236958]
    automated match to d1uwfa_
    complexed with kgm

Details for d4buqb_

PDB Entry: 4buq (more details), 2.2 Å

PDB Description: Crystal structure of wild type FimH lectin domain in complex with heptyl alpha-D-mannopyrannoside
PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d4buqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4buqb_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4buqb_:

Click to download the PDB-style file with coordinates for d4buqb_.
(The format of our PDB-style files is described here.)

Timeline for d4buqb_: