Lineage for d4bkmd_ (4bkm D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394651Species Mus musculus, [TaxId:10090] [234193] (1 PDB entry)
  8. 1394655Domain d4bkmd_: 4bkm D: [236957]
    automated match to d4bkmb_
    complexed with mg, no3

Details for d4bkmd_

PDB Entry: 4bkm (more details), 2.5 Å

PDB Description: crystal structure of the murine aum (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase)
PDB Compounds: (D:) pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bkmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkmd_ c.108.1.0 (D:) automated matches {Mus musculus, [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
megl

SCOPe Domain Coordinates for d4bkmd_:

Click to download the PDB-style file with coordinates for d4bkmd_.
(The format of our PDB-style files is described here.)

Timeline for d4bkmd_: