Lineage for d4bkmd_ (4bkm D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920557Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2920570Domain d4bkmd_: 4bkm D: [236957]
    automated match to d4bkmb_
    complexed with mg, no3

Details for d4bkmd_

PDB Entry: 4bkm (more details), 2.65 Å

PDB Description: crystal structure of the murine aum (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase)
PDB Compounds: (D:) pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bkmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkmd_ c.108.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
megl

SCOPe Domain Coordinates for d4bkmd_:

Click to download the PDB-style file with coordinates for d4bkmd_.
(The format of our PDB-style files is described here.)

Timeline for d4bkmd_: