| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.1: MutT-like [55812] (17 proteins) |
| Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries) |
| Domain d3whwa_: 3whw A: [236954] automated match to d1irya_ complexed with rux, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3whw (more details), 2.7 Å
SCOPe Domain Sequences for d3whwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whwa_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv
Timeline for d3whwa_: