Lineage for d3weja_ (3wej A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282040Family a.128.1.2: Squalene synthase [48580] (2 proteins)
    automatically mapped to Pfam PF00494
  6. 1282046Protein automated matches [191305] (1 species)
    not a true protein
  7. 1282047Species Human (Homo sapiens) [TaxId:9606] [190011] (15 PDB entries)
  8. 1282069Domain d3weja_: 3wej A: [236952]
    automated match to d3vjbc_
    complexed with mg, ps7; mutant

Details for d3weja_

PDB Entry: 3wej (more details), 2 Å

PDB Description: crystal structure of the human squalene synthase f288a mutant in complex with presqualene pyrophosphate
PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3weja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3weja_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkv
pllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigm
aefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqkt
niirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvi
tylsrlrnqsvfnacaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpav
kaiiyqymeeiyhripdsdpsssktrqiistirtq

SCOPe Domain Coordinates for d3weja_:

Click to download the PDB-style file with coordinates for d3weja_.
(The format of our PDB-style files is described here.)

Timeline for d3weja_: