SCOP 1.73: Domain d1ezua_: 1ezu A:

Lineage for d1ezua_ (1ezu A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)

8. Domain d1ezua_: 1ezu A: [23695]
   Other proteins in same PDB: d1ezuc_, d1ezud_

Details for d1ezua_

PDB Entry: 1ezu, 2.4 Å

PDB Description: ecotin y69f, d70p bound to d102n trypsin

PDB Compounds: (A:) ecotin

SCOP Domain Sequences for d1ezua_:

Sequence; same for both SEQRES and ATOM records:

>d1ezua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
tlegwgfpyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
vdvkyrvwkaeekidnavvr

Timeline for d1ezua_:

• d1ezua_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezua_ appears in SCOP 1.71
  
• d1ezua_ appears in SCOP 1.75
  
• d1ezua_ appears in the current release, SCOPe 2.08