Class b: All beta proteins [48724] (165 folds) |
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) |
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
Protein Ecotin, trypsin inhibitor [49774] (1 species) |
Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) |
Domain d1ezua_: 1ezu A: [23695] Other proteins in same PDB: d1ezuc_, d1ezud_ |
PDB Entry: 1ezu (more details), 2.4 Å
SCOP Domain Sequences for d1ezua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk tlegwgfpyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn vdvkyrvwkaeekidnavvr
Timeline for d1ezua_: