| Class b: All beta proteins [48724] (180 folds) |
| Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
| Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
| Protein Ecotin, trypsin inhibitor [49774] (1 species) |
| Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
| Domain d1ezua_: 1ezu A: [23695] Other proteins in same PDB: d1ezuc_, d1ezud_ complexed with ca |
PDB Entry: 1ezu (more details), 2.4 Å
SCOPe Domain Sequences for d1ezua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
tlegwgfpyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
vdvkyrvwkaeekidnavvr
Timeline for d1ezua_: