SCOPe 2.03: Domain d3weia_: 3wei A:

Lineage for d3weia_ (3wei A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.2: Squalene synthase [48580] (2 proteins)
   automatically mapped to Pfam PF00494

6. Protein automated matches [191305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [190011] (15 PDB entries)

8. Domain d3weia_: 3wei A: [236949]
   automated match to d3vjbc_
   complexed with mn, ps7; mutant

Details for d3weia_

PDB Entry: 3wei, 1.79 Å

PDB Description: crystal structure of the human squalene synthase y73a mutant in complex with presqualene pyrophosphate

PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3weia_:

Sequence; same for both SEQRES and ATOM records:

>d3weia_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifalvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavk
aiiyqymeeiyhripdsdpsssktrqiistirtq

Timeline for d3weia_:

• d3weia_ is new in SCOPe 2.03-stable
  
• d3weia_ appears in SCOPe 2.04
  
• d3weia_ appears in the current release, SCOPe 2.08