Lineage for d3wefb_ (3wef B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731599Family a.128.1.2: Squalene synthase [48580] (2 proteins)
    automatically mapped to Pfam PF00494
  6. 2731605Protein automated matches [191305] (1 species)
    not a true protein
  7. 2731606Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 2731675Domain d3wefb_: 3wef B: [236945]
    automated match to d3vj8a_
    complexed with fps

Details for d3wefb_

PDB Entry: 3wef (more details), 2.35 Å

PDB Description: crystal structure of the human squalene synthase in complex with farnesyl thiopyrophosphate
PDB Compounds: (B:) Squalene synthase

SCOPe Domain Sequences for d3wefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wefb_ a.128.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpl
lhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmae
fldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktni
irdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvity
lsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavka
iiyqymeeiyhripdsdpsssktrqiistirtq

SCOPe Domain Coordinates for d3wefb_:

Click to download the PDB-style file with coordinates for d3wefb_.
(The format of our PDB-style files is described here.)

Timeline for d3wefb_: