SCOPe 2.05: Domain d3wefc_: 3wef C:

Lineage for d3wefc_ (3wef C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.2: Squalene synthase [48580] (2 proteins)
   automatically mapped to Pfam PF00494

6. Protein automated matches [191305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)

8. Domain d3wefc_: 3wef C: [236943]
   automated match to d3vj8a_
   complexed with fps

Details for d3wefc_

PDB Entry: 3wef, 2.35 Å

PDB Description: crystal structure of the human squalene synthase in complex with farnesyl thiopyrophosphate

PDB Compounds: (C:) Squalene synthase

SCOPe Domain Sequences for d3wefc_:

Sequence; same for both SEQRES and ATOM records:

>d3wefc_ a.128.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavk
aiiyqymeeiyhripdsdpsssktrqiistirt

Timeline for d3wefc_:

• d3wefc_ first appeared in SCOPe 2.03
  
• d3wefc_ appears in SCOPe 2.04
  
• d3wefc_ appears in SCOPe 2.06
  
• d3wefc_ appears in the current release, SCOPe 2.08