Lineage for d1fi8.2 (1fi8 E:,F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12020Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 12021Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 12022Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 12023Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 12024Species Escherichia coli [TaxId:562] [49775] (10 PDB entries)
  8. 12034Domain d1fi8.2: 1fi8 E:,F: [23694]
    Other proteins in same PDB: d1fi8a_, d1fi8b_

Details for d1fi8.2

PDB Entry: 1fi8 (more details), 2.2 Å

PDB Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
PDB Compounds: (E:) , (F:)

SCOP Domain Sequences for d1fi8.2:

Sequence, based on SEQRES records: (download)

>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaee
kidnavvr

Sequence, based on observed residues (ATOM records): (download)

>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
wgydyyvfdsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

SCOP Domain Coordinates for d1fi8.2:

Click to download the PDB-style file with coordinates for d1fi8.2.
(The format of our PDB-style files is described here.)

Timeline for d1fi8.2: