![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
![]() | Domain d1fi8.2: 1fi8 E:,F: [23694] Other proteins in same PDB: d1fi8a_, d1fi8b_ |
PDB Entry: 1fi8 (more details), 2.2 Å
SCOPe Domain Sequences for d1fi8.2:
Sequence, based on SEQRES records: (download)
>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle gwgydyyvfdkvsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaee kidnavvr
>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg wgydyyvfdsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid navvr
Timeline for d1fi8.2: