SCOPe 2.08: Domain d1fi8.2: 1fi8 E:,F:

Lineage for d1fi8.2 (1fi8 E:,F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1fi8.2: 1fi8 E:,F: [23694]
   Other proteins in same PDB: d1fi8a_, d1fi8b_

Details for d1fi8.2

PDB Entry: 1fi8, 2.2 Å

PDB Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]

PDB Compounds: (E:) ecotin, (F:) ecotin

SCOPe Domain Sequences for d1fi8.2:

Sequence, based on SEQRES records:

>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaee
kidnavvr

Sequence, based on observed residues (ATOM records):

>g1fi8.2 b.16.1.1 (E:,F:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
wgydyyvfdsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

Timeline for d1fi8.2:

• d1fi8.2 first appeared (with stable ids) in SCOP 1.55
  
• d1fi8.2 appears in SCOPe 2.07