Lineage for d4onea_ (4one A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846249Species Brucella melitensis [TaxId:224914] [236934] (2 PDB entries)
  8. 2846250Domain d4onea_: 4one A: [236938]
    automated match to d1gege_
    complexed with cl, mpd

Details for d4onea_

PDB Entry: 4one (more details), 1.65 Å

PDB Description: crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase from brucella melitensis
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d4onea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onea_ c.2.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs
aihadgglsiakl

SCOPe Domain Coordinates for d4onea_:

Click to download the PDB-style file with coordinates for d4onea_.
(The format of our PDB-style files is described here.)

Timeline for d4onea_: