SCOPe 2.05: Domain d4olja_: 4olj A:

Lineage for d4olja_ (4olj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (7 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (11 PDB entries)

8. Domain d4olja_: 4olj A: [236933]
   automated match to d4lwra_
   complexed with gol, tla; mutant

Details for d4olja_

PDB Entry: 4olj, 1.49 Å

PDB Description: Crystal structure of Arg119Gln mutant of Peptidyl-tRNA Hydrolase from Acinetobacter Baumannii at 1.49 A resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4olja_:

Sequence; same for both SEQRES and ATOM records:

>d4olja_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
lqdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
gqvpqamnqinaykpa

Timeline for d4olja_:

• d4olja_ first appeared in SCOPe 2.03
  
• d4olja_ appears in SCOPe 2.04
  
• d4olja_ is called d4olja1 in SCOPe 2.06
  
• d4olja_ appears in the current release, SCOPe 2.08, called d4olja1