| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
| Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
| Protein automated matches [193326] (11 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries) |
| Domain d4olja1: 4olj A:1-193 [236933] Other proteins in same PDB: d4olja2 automated match to d4lwra_ complexed with gol, tla; mutant |
PDB Entry: 4olj (more details), 1.49 Å
SCOPe Domain Sequences for d4olja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4olja1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglqd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa
Timeline for d4olja1: