SCOPe 2.07: Domain d1fi8.1: 1fi8 C:,D:

Lineage for d1fi8.1 (1fi8 C:,D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1fi8.1: 1fi8 C:,D: [23693]
   Other proteins in same PDB: d1fi8a_, d1fi8b_

Details for d1fi8.1

PDB Entry: 1fi8, 2.2 Å

PDB Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]

PDB Compounds: (C:) ecotin, (D:) ecotin

SCOPe Domain Sequences for d1fi8.1:

Sequence, based on SEQRES records:

>g1fi8.1 b.16.1.1 (C:,D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaee
kidnavvr

Sequence, based on observed residues (ATOM records):

>g1fi8.1 b.16.1.1 (C:,D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdclhrlggklenktleg
wgydyyvfdkvsspiepdXkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeek
idnavvr

Timeline for d1fi8.1:

• d1fi8.1 first appeared (with stable ids) in SCOP 1.55
  
• d1fi8.1 appears in SCOPe 2.06
  
• d1fi8.1 appears in the current release, SCOPe 2.08