SCOPe 2.03: Domain d4no1i_: 4no1 I:

Lineage for d4no1i_ (4no1 I:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4no1i_: 4no1 I: [236914]
   Other proteins in same PDB: d4no1b_, d4no1c_, d4no1d_, d4no1e_, d4no1g_, d4no1h_, d4no1p_, d4no1q_, d4no1r_, d4no1s_, d4no1u_, d4no1v_
   automated match to d1g0ui_
   complexed with cix, mg

Details for d4no1i_

PDB Entry: 4no1, 2.5 Å

PDB Description: ycp in complex with z-leu-leu-leu-b(oh)2

PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d4no1i_:

Sequence; same for both SEQRES and ATOM records:

>d4no1i_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d4no1i_:

• d4no1i_ is new in SCOPe 2.03-stable
  
• d4no1i_ appears in SCOPe 2.04
  
• d4no1i_ appears in the current release, SCOPe 2.08