Class b: All beta proteins [48724] (177 folds) |
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) automatically mapped to Pfam PF03974 |
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
Protein Ecotin, trypsin inhibitor [49774] (1 species) |
Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
Domain d1azzc_: 1azz C: [23691] Other proteins in same PDB: d1azza_, d1azzb_ |
PDB Entry: 1azz (more details), 2.3 Å
SCOPe Domain Sequences for d1azzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azzc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle gwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv kyrvwkaeekidnavvr
Timeline for d1azzc_: