SCOP 1.73: Domain d1azzc_: 1azz C:

Lineage for d1azzc_ (1azz C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)

8. Domain d1azzc_: 1azz C: [23691]
   Other proteins in same PDB: d1azza_, d1azzb_

Details for d1azzc_

PDB Entry: 1azz, 2.3 Å

PDB Description: fiddler crab collagenase complexed to ecotin

PDB Compounds: (C:) ecotin

SCOP Domain Sequences for d1azzc_:

Sequence; same for both SEQRES and ATOM records:

>d1azzc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

Timeline for d1azzc_:

• d1azzc_ first appeared (with stable ids) in SCOP 1.55
  
• d1azzc_ appears in SCOP 1.71
  
• d1azzc_ appears in SCOP 1.75
  
• d1azzc_ appears in the current release, SCOPe 2.08