Lineage for d1azzc_ (1azz C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107936Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 107937Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 107938Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 107939Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 107940Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)
  8. 107947Domain d1azzc_: 1azz C: [23691]
    Other proteins in same PDB: d1azza_, d1azzb_

Details for d1azzc_

PDB Entry: 1azz (more details), 2.3 Å

PDB Description: fiddler crab collagenase complexed to ecotin

SCOP Domain Sequences for d1azzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azzc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

SCOP Domain Coordinates for d1azzc_:

Click to download the PDB-style file with coordinates for d1azzc_.
(The format of our PDB-style files is described here.)

Timeline for d1azzc_: