Lineage for d4no9p_ (4no9 P:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228616Domain d4no9p_: 4no9 P: [236901]
    Other proteins in same PDB: d4no9a_, d4no9e_, d4no9f_, d4no9i_, d4no9j_, d4no9k_, d4no9l_, d4no9n_, d4no9o_, d4no9s_, d4no9t_, d4no9w_, d4no9x_, d4no9y_, d4no9z_
    automated match to d2zcyb_
    complexed with 2l0, 2lr, mg

Details for d4no9p_

PDB Entry: 4no9 (more details), 2.9 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-epoxyketone
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4no9p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no9p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4no9p_:

Click to download the PDB-style file with coordinates for d4no9p_.
(The format of our PDB-style files is described here.)

Timeline for d4no9p_: