SCOPe 2.06: Domain d1ezsb_: 1ezs B:

Lineage for d1ezsb_ (1ezs B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1ezsb_: 1ezs B: [23690]
   Other proteins in same PDB: d1ezsc_, d1ezsd_
   complexed with ca; mutant

Details for d1ezsb_

PDB Entry: 1ezs, 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

PDB Compounds: (B:) ecotin

SCOPe Domain Sequences for d1ezsb_:

Sequence, based on SEQRES records:

>d1ezsb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegaaaay
yvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1ezsb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

Timeline for d1ezsb_:

• d1ezsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ezsb_ appears in SCOPe 2.05
  
• d1ezsb_ appears in SCOPe 2.07
  
• d1ezsb_ appears in the current release, SCOPe 2.08