Lineage for d1ezsb_ (1ezs B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107936Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 107937Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 107938Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 107939Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 107940Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)
  8. 107945Domain d1ezsb_: 1ezs B: [23690]
    Other proteins in same PDB: d1ezsc_, d1ezsd_

Details for d1ezsb_

PDB Entry: 1ezs (more details), 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

SCOP Domain Sequences for d1ezsb_:

Sequence, based on SEQRES records: (download)

>d1ezsb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegaaaay
yvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1ezsb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

SCOP Domain Coordinates for d1ezsb_:

Click to download the PDB-style file with coordinates for d1ezsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ezsb_: