Lineage for d1ezsa_ (1ezs A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57141Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 57142Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 57143Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 57144Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 57145Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)
  8. 57149Domain d1ezsa_: 1ezs A: [23689]
    Other proteins in same PDB: d1ezsc_, d1ezsd_

Details for d1ezsa_

PDB Entry: 1ezs (more details), 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii

SCOP Domain Sequences for d1ezsa_:

Sequence, based on SEQRES records: (download)

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegaaaay
yvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

SCOP Domain Coordinates for d1ezsa_:

Click to download the PDB-style file with coordinates for d1ezsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ezsa_: