Lineage for d1ezsa_ (1ezs A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369490Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2369491Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2369492Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 protein domains)
  6. 2369493Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2369494Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2369499Domain d1ezsa_: 1ezs A: [23689]
    Other proteins in same PDB: d1ezsc_, d1ezsd_
    complexed with ca; mutant

Details for d1ezsa_

PDB Entry: 1ezs (more details), 2.3 Å

PDB Description: crystal structure of ecotin mutant m84r, w67a, g68a, y69a, d70a bound to rat anionic trypsin ii
PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1ezsa_:

Sequence, based on SEQRES records: (download)

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegaaaay
yvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1ezsa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
pypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktayyvfdkv
sspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwkaeekid
navvr

SCOPe Domain Coordinates for d1ezsa_:

Click to download the PDB-style file with coordinates for d1ezsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ezsa_: