Lineage for d1slva_ (1slv A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039048Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2039049Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2039050Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 protein domains)
  6. 2039051Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2039052Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2039057Domain d1slva_: 1slv A: [23688]
    Other proteins in same PDB: d1slvb_
    complexed with act, ca, cu

Details for d1slva_

PDB Entry: 1slv (more details), 2.3 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; copper-bound
PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1slva_:

Sequence, based on SEQRES records: (download)

>d1slva_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrv
wkaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1slva_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwka
eekidnavvr

SCOPe Domain Coordinates for d1slva_:

Click to download the PDB-style file with coordinates for d1slva_.
(The format of our PDB-style files is described here.)

Timeline for d1slva_: