Lineage for d4no8u_ (4no8 U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599700Domain d4no8u_: 4no8 U: [236877]
    Other proteins in same PDB: d4no8a_, d4no8e_, d4no8f_, d4no8i_, d4no8j_, d4no8k_, d4no8l_, d4no8n_, d4no8o_, d4no8s_, d4no8t_, d4no8w_, d4no8x_, d4no8y_, d4no8z_
    automated match to d2zcyg_
    complexed with 2lv, mg

Details for d4no8u_

PDB Entry: 4no8 (more details), 2.7 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoamide
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4no8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no8u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4no8u_:

Click to download the PDB-style file with coordinates for d4no8u_.
(The format of our PDB-style files is described here.)

Timeline for d4no8u_: