SCOPe 2.08: Domain d1slxa_: 1slx A:

Lineage for d1slxa_ (1slx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1slxa_: 1slx A: [23687]
   Other proteins in same PDB: d1slxb_
   complexed with act, ca, zn

Details for d1slxa_

PDB Entry: 1slx, 2.2 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; zinc-bound

PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1slxa_:

Sequence, based on SEQRES records:

>d1slxa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrv
wkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1slxa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Timeline for d1slxa_:

• d1slxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1slxa_ appears in SCOPe 2.07