Lineage for d1slwa_ (1slw A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12020Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 12021Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 12022Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 12023Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 12024Species Escherichia coli [TaxId:562] [49775] (10 PDB entries)
  8. 12026Domain d1slwa_: 1slw A: [23686]
    Other proteins in same PDB: d1slwb_

Details for d1slwa_

PDB Entry: 1slw (more details), 2 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound

SCOP Domain Sequences for d1slwa_:

Sequence, based on SEQRES records: (download)

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvw
kaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwka
eekidnavvr

SCOP Domain Coordinates for d1slwa_:

Click to download the PDB-style file with coordinates for d1slwa_.
(The format of our PDB-style files is described here.)

Timeline for d1slwa_: