SCOPe 2.08: Domain d1slwa_: 1slw A:

Lineage for d1slwa_ (1slw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1slwa_: 1slw A: [23686]
   Other proteins in same PDB: d1slwb_
   complexed with act, ca, ni

Details for d1slwa_

PDB Entry: 1slw, 2 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel- bound

PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1slwa_:

Sequence, based on SEQRES records:

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvw
kaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwka
eekidnavvr

Timeline for d1slwa_:

• d1slwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1slwa_ appears in SCOPe 2.07