Lineage for d1slwa_ (1slw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369490Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2369491Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2369492Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 protein domains)
  6. 2369493Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2369494Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2369496Domain d1slwa_: 1slw A: [23686]
    Other proteins in same PDB: d1slwb_
    complexed with act, ca, ni

Details for d1slwa_

PDB Entry: 1slw (more details), 2 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound
PDB Compounds: (A:) ecotin

SCOPe Domain Sequences for d1slwa_:

Sequence, based on SEQRES records: (download)

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvw
kaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1slwa_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
apypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgyd
yyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwka
eekidnavvr

SCOPe Domain Coordinates for d1slwa_:

Click to download the PDB-style file with coordinates for d1slwa_.
(The format of our PDB-style files is described here.)

Timeline for d1slwa_: