Class b: All beta proteins [48724] (174 folds) |
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) |
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
Protein Ecotin, trypsin inhibitor [49774] (1 species) |
Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
Domain d1slua_: 1slu A: [23685] Other proteins in same PDB: d1slub_ complexed with act, ca; mutant |
PDB Entry: 1slu (more details), 1.8 Å
SCOP Domain Sequences for d1slua_:
Sequence, based on SEQRES records: (download)
>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy dyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrv wkaeekidnavvr
>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy dyyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk aeekidnavvr
Timeline for d1slua_: