Lineage for d1slua_ (1slu A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163891Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
  4. 163892Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 163893Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 163894Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 163895Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)
  8. 163896Domain d1slua_: 1slu A: [23685]
    Other proteins in same PDB: d1slub_

Details for d1slua_

PDB Entry: 1slu (more details), 1.8 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin

SCOP Domain Sequences for d1slua_:

Sequence, based on SEQRES records: (download)

>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrv
wkaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

SCOP Domain Coordinates for d1slua_:

Click to download the PDB-style file with coordinates for d1slua_.
(The format of our PDB-style files is described here.)

Timeline for d1slua_: