SCOP 1.55: Domain d1slua_: 1slu A:

Lineage for d1slua_ (1slu A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (10 PDB entries)

8. Domain d1slua_: 1slu A: [23685]
   Other proteins in same PDB: d1slub_

Details for d1slua_

PDB Entry: 1slu, 1.8 Å

PDB Description: rat anionic n143h, e151h trypsin complexed to a86h ecotin

SCOP Domain Sequences for d1slua_:

Sequence, based on SEQRES records:

>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrv
wkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1slua_ b.16.1.1 (A:) Ecotin, trypsin inhibitor {Escherichia coli}
iapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktlegwgy
dyyvfdkvsspvstmmhcpdkekkfvtaylgdagmlrynsklpivvytpdnvdvkyrvwk
aeekidnavvr

Timeline for d1slua_:

• d1slua_ appears in SCOP 1.57
  
• d1slua_ appears in the current release, SCOPe 2.08