SCOPe 2.08: Domain d1ejfb_: 1ejf B:

Lineage for d1ejfb_ (1ejf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.2: Co-chaperone p23-like [49768] (1 protein)

6. Protein Co-chaperone p23 [49769] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49770] (1 PDB entry)

8. Domain d1ejfb_: 1ejf B: [23684]
   complexed with so4

Details for d1ejfb_

PDB Entry: 1ejf, 2.49 Å

PDB Description: crystal structure of the human co-chaperone p23

PDB Compounds: (B:) Prostaglandin E synthase 3

SCOPe Domain Sequences for d1ejfb_:

Sequence; same for both SEQRES and ATOM records:

>d1ejfb_ b.15.1.2 (B:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]}
mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdwe

Timeline for d1ejfb_:

• d1ejfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ejfb_ appears in SCOPe 2.07