Lineage for d4nnnu_ (4nnn U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228629Domain d4nnnu_: 4nnn U: [236833]
    Other proteins in same PDB: d4nnna_, d4nnne_, d4nnnf_, d4nnni_, d4nnnj_, d4nnnk_, d4nnnl_, d4nnnn_, d4nnno_, d4nnns_, d4nnnt_, d4nnnw_, d4nnnx_, d4nnny_, d4nnnz_
    automated match to d2zcyg_
    complexed with ald, mg

Details for d4nnnu_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4nnnu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4nnnu_:

Click to download the PDB-style file with coordinates for d4nnnu_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnu_: