Lineage for d1ejfa_ (1ejf A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. Family b.15.1.2: Co-chaperone p23-like [49768] (1 protein)
  6. Protein Co-chaperone p23 [49769] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49770] (1 PDB entry)
  8. Domain d1ejfa_: 1ejf A: [23683]
    complexed with so4

Details for d1ejfa_

PDB Entry: 1ejf (more details), 2.4899999999999998 Å

PDB Description: crystal structure of the human co-chaperone p23
PDB Compounds: (A:) Prostaglandin E synthase 3

SCOPe Domain Sequences for d1ejfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]}
mqpasakwydrrdyvfiefcvedskdvnvnfekskltfsclggsdnfkhlneidlfhcid
pndskhkrtdrsilcclrkgesgqswprltkeraklnwlsvdfnnwkdwe

SCOPe Domain Coordinates for d1ejfa_ are not available.

Timeline for d1ejfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ejfb_