Lineage for d4na7a_ (4na7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798248Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. 2798412Domain d4na7a_: 4na7 A: [236812]
    automated match to d3bsqa_
    complexed with 1t5, so4

Details for d4na7a_

PDB Entry: 4na7 (more details), 2.8 Å

PDB Description: Factor XIA in complex with the inhibitor 3'-[(2S,4R)-6-carbamimidoyl-4-methyl-4-phenyl-1,2,3,4-tetrahydroquinolin-2-yl]-4-carbamoyl-5'-[(3-methylbutanoyl)amino]biphenyl-2-carboxylic acid
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4na7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4na7a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4na7a_:

Click to download the PDB-style file with coordinates for d4na7a_.
(The format of our PDB-style files is described here.)

Timeline for d4na7a_: