Lineage for d4na9l_ (4na9 L:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961216Protein Coagulation factor VIIa [57201] (1 species)
  7. 1961217Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1961274Domain d4na9l_: 4na9 L: [236810]
    Other proteins in same PDB: d4na9h_
    automated match to d1w7xl_
    complexed with 1t7, ca

Details for d4na9l_

PDB Entry: 4na9 (more details), 2.24 Å

PDB Description: Factor VIIa in complex with the inhibitor 3'-amino-5'-[(2s,4r)-6-carbamimidoyl-4-phenyl-1,2,3,4-tetrahydroquinolin-2-yl]biphenyl-2-carboxylic acid
PDB Compounds: (L:) Coagulation factor VII light chain

SCOPe Domain Sequences for d4na9l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4na9l_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d4na9l_:

Click to download the PDB-style file with coordinates for d4na9l_.
(The format of our PDB-style files is described here.)

Timeline for d4na9l_: