SCOPe 2.05: Domain d4luda1: 4lud A:85-146

Lineage for d4luda1 (4lud A:85-146)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Hemapoetic cell kinase Hck [50062] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)

8. Domain d4luda1: 4lud A:85-146 [236787]
   Other proteins in same PDB: d4luda2, d4luda3, d4ludb2, d4ludb3
   automated match to d1qcfa1
   complexed with ca, cl, gol, sk8

Details for d4luda1

PDB Entry: 4lud, 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luda1:

Sequence, based on SEQRES records:

>d4luda1 b.34.2.1 (A:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Sequence, based on observed residues (ATOM records):

>d4luda1 b.34.2.1 (A:85-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarlet

Timeline for d4luda1:

• d4luda1 first appeared in SCOPe 2.03
  
• d4luda1 appears in SCOPe 2.04
  
• d4luda1 appears in SCOPe 2.06
  
• d4luda1 appears in the current release, SCOPe 2.08