Lineage for d4ludb3 (4lud B:250-529)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434765Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1434766Species Human (Homo sapiens) [TaxId:9606] [56152] (17 PDB entries)
  8. 1434796Domain d4ludb3: 4lud B:250-529 [236786]
    Other proteins in same PDB: d4luda1, d4luda2, d4ludb1, d4ludb2
    automated match to d1qcfa3
    complexed with ca, cl, gol, sk8

Details for d4ludb3

PDB Entry: 4lud (more details), 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4ludb3:

Sequence, based on SEQRES records: (download)

>d4ludb3 d.144.1.7 (B:250-529) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyee

Sequence, based on observed residues (ATOM records): (download)

>d4ludb3 d.144.1.7 (B:250-529) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsveaflaea
nvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqia
egmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftiksd
vwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpe
erptfeyiqsvlddfytatesqyee

SCOPe Domain Coordinates for d4ludb3:

Click to download the PDB-style file with coordinates for d4ludb3.
(The format of our PDB-style files is described here.)

Timeline for d4ludb3: