Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
Domain d4ludb2: 4lud B:147-249 [236785] Other proteins in same PDB: d4luda1, d4luda3, d4luda4, d4ludb1, d4ludb3, d4ludb4 automated match to d1qcfa2 complexed with ca, cl, gol, sk8 |
PDB Entry: 4lud (more details), 2.85 Å
SCOPe Domain Sequences for d4ludb2:
Sequence, based on SEQRES records: (download)
>d4ludb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
>d4ludb2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsetsyslsvrdydprqgdtvkhykitlqe lvdhykkgndglcqklsvpcmss
Timeline for d4ludb2:
View in 3D Domains from other chains: (mouse over for more information) d4luda1, d4luda2, d4luda3, d4luda4 |