Lineage for d4ludb1 (4lud B:86-146)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053913Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2053914Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2053956Domain d4ludb1: 4lud B:86-146 [236784]
    Other proteins in same PDB: d4luda2, d4luda3, d4luda4, d4ludb2, d4ludb3, d4ludb4
    automated match to d1qcfa1
    complexed with ca, cl, gol, sk8

Details for d4ludb1

PDB Entry: 4lud (more details), 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4ludb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ludb1 b.34.2.1 (B:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d4ludb1:

Click to download the PDB-style file with coordinates for d4ludb1.
(The format of our PDB-style files is described here.)

Timeline for d4ludb1: